Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.23: Papain-like viral protease catalytic domain [310648] (2 proteins) C-terminal part of Pfam PF08715 |
Protein automated matches [310868] (6 species) not a true protein |
Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [385225] (34 PDB entries) |
Domain d6wzua2: 6wzu A:62-315 [386400] Other proteins in same PDB: d6wzua1 automated match to d2fe8a2 complexed with cl, gol, po4, zn |
PDB Entry: 6wzu (more details), 1.79 Å
SCOPe Domain Sequences for d6wzua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6wzua2 d.3.1.23 (A:62-315) automated matches {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]} dtlrveafeyyhttdpsflgrymsalnhtkkwkypqvngltsikwadnncylatalltlq qielkfnppalqdayyrarageaanfcalilaycnktvgelgdvretmsylfqhanldsc krvlnvvcktcgqqqttlkgveavmymgtlsyeqfkkgvqipctcgkqatkylvqqespf vmmsappaqyelkhgtftcaseytgnyqcghykhitsketlycidgalltksseykgpit dvfykensytttik
Timeline for d6wzua2: