SCOP 1.55: Domain d1a68__: 1a68 -

Lineage for d1a68__ (1a68 -)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)

4. Superfamily d.42.1: POZ domain [54695] (2 families)

5. Family d.42.1.2: Tetramerization domain of potassium channels [54701] (5 proteins)

6. Protein Shaker potassium channel [54702] (1 species)

7. Species California sea hare (Aplysia californica) [TaxId:6500] [54703] (5 PDB entries)

8. Domain d1a68__: 1a68 - [38639]

Details for d1a68__

PDB Entry: 1a68, 1.8 Å

PDB Description: crystal structure of the tetramerization domain of the shaker potassium channel

SCOP Domain Sequences for d1a68__:

Sequence; same for both SEQRES and ATOM records:

>d1a68__ d.42.1.2 (-) Shaker potassium channel {California sea hare (Aplysia californica)}
ervvinvsglrfetqlktlnqfpdtllgnpqkrnryydplrneyffdrnrpsfdailyfy
qsggrlrrpvnvpldvfseeikfyelg

Timeline for d1a68__:

• d1a68__ appears in SCOP 1.57
  
• d1a68__ appears in the current release, SCOPe 2.08, called d1a68a_