SCOPe 2.08: Domain d6umpc_: 6ump C:

Lineage for d6umpc_ (6ump C:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species)

7. Species Human (Homo sapiens), ubc13 [TaxId:9606] [64240] (23 PDB entries)

8. Domain d6umpc_: 6ump C: [386386]
   Other proteins in same PDB: d6umpe_
   automated match to d1j7db_

Details for d6umpc_

PDB Entry: 6ump, 2.8 Å

PDB Description: crystal structure of mavc in complex with substrate mimic in p65 space group

PDB Compounds: (C:) Ubiquitin-conjugating enzyme E2 N

SCOPe Domain Sequences for d6umpc_:

Sequence; same for both SEQRES and ATOM records:

>d6umpc_ d.20.1.1 (C:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]}
glprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpeey
pmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddpla
ndvaeqwktneaqaietarawtrlyamnni

Timeline for d6umpc_:

• d6umpc_ first appeared in SCOPe 2.07