![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
![]() | Superfamily d.20.1: UBC-like [54495] (5 families) ![]() |
![]() | Family d.20.1.1: UBC-related [54496] (7 proteins) |
![]() | Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species) |
![]() | Species Human (Homo sapiens), ubc13 [TaxId:9606] [64240] (18 PDB entries) |
![]() | Domain d6umpc_: 6ump C: [386386] Other proteins in same PDB: d6umpe_ automated match to d1j7db_ |
PDB Entry: 6ump (more details), 2.8 Å
SCOPe Domain Sequences for d6umpc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6umpc_ d.20.1.1 (C:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]} glprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpeey pmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddpla ndvaeqwktneaqaietarawtrlyamnni
Timeline for d6umpc_: