Lineage for d6ulhc_ (6ulh C:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2507728Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2507729Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2507730Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2507738Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species)
  7. 2507829Species Human (Homo sapiens), ubc13 [TaxId:9606] [64240] (18 PDB entries)
  8. 3086322Domain d6ulhc_: 6ulh C: [386384]
    Other proteins in same PDB: d6ulhe_
    automated match to d1j7db_

Details for d6ulhc_

PDB Entry: 6ulh (more details), 1.97 Å

PDB Description: structure of mavc in complex with its substrate in r3 spacegroup
PDB Compounds: (C:) Ubiquitin-conjugating enzyme E2 N

SCOPe Domain Sequences for d6ulhc_:

Sequence, based on SEQRES records: (download)

>d6ulhc_ d.20.1.1 (C:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]}
aglprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpee
ypmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddpl
andvaeqwktneaqaietarawtrlyamnni

Sequence, based on observed residues (ATOM records): (download)

>d6ulhc_ d.20.1.1 (C:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]}
aglprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpee
ypmaapkvrfmtkiyhpnvdklgriclwspalqirtvllsiqallsapnpddplandvae
qwktneaqaietarawtrlyamnni

SCOPe Domain Coordinates for d6ulhc_:

Click to download the PDB-style file with coordinates for d6ulhc_.
(The format of our PDB-style files is described here.)

Timeline for d6ulhc_:

  • d6ulhc_ is new in SCOPe 2.07-stable

View in 3D
Domains from other chains:
(mouse over for more information)
d6ulhe_