![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
![]() | Superfamily d.42.1: POZ domain [54695] (3 families) ![]() |
![]() | Family d.42.1.2: Tetramerization domain of potassium channels [54701] (7 proteins) |
![]() | Protein Shaker potassium channel [54702] (1 species) |
![]() | Species California sea hare (Aplysia californica) [TaxId:6500] [54703] (5 PDB entries) |
![]() | Domain d1eoea_: 1eoe A: [38638] mutant |
PDB Entry: 1eoe (more details), 1.7 Å
SCOPe Domain Sequences for d1eoea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eoea_ d.42.1.2 (A:) Shaker potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} ervvinvsglrfetqlktlnqfpdtllgnpqkrnryydplrneyffdrnrpsfdailyfy qsggrlrrprnvpldvfseeikfyelgenaferyredegf
Timeline for d1eoea_: