Lineage for d1vcbe_ (1vcb E:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1202046Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 1202047Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 1202048Family d.42.1.1: BTB/POZ domain [54696] (5 proteins)
  6. 1202095Protein Elongin C [54699] (3 species)
  7. 1202098Species Human (Homo sapiens) [TaxId:9606] [54700] (9 PDB entries)
  8. 1202109Domain d1vcbe_: 1vcb E: [38634]
    Other proteins in same PDB: d1vcba_, d1vcbc_, d1vcbd_, d1vcbf_, d1vcbg_, d1vcbi_, d1vcbj_, d1vcbl_

Details for d1vcbe_

PDB Entry: 1vcb (more details), 2.7 Å

PDB Description: the vhl-elonginc-elonginb structure
PDB Compounds: (E:) protein (elongin c)

SCOPe Domain Sequences for d1vcbe_:

Sequence, based on SEQRES records: (download)

>d1vcbe_ d.42.1.1 (E:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
ftykvrytnssteipefpiapeialellmaanfldc

Sequence, based on observed residues (ATOM records): (download)

>d1vcbe_ d.42.1.1 (E:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgpnevnfreipshvlskvcmyftykvryt
nssteipefpiapeialellmaanfldc

SCOPe Domain Coordinates for d1vcbe_:

Click to download the PDB-style file with coordinates for d1vcbe_.
(The format of our PDB-style files is described here.)

Timeline for d1vcbe_: