Lineage for d1cs3a_ (1cs3 A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1024736Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 1024737Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 1024738Family d.42.1.1: BTB/POZ domain [54696] (5 proteins)
  6. 1024804Protein Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain [54697] (1 species)
  7. 1024805Species Human (Homo sapiens) [TaxId:9606] [54698] (2 PDB entries)
  8. 1024807Domain d1cs3a_: 1cs3 A: [38632]
    complexed with gol, mg

Details for d1cs3a_

PDB Entry: 1cs3 (more details), 2 Å

PDB Description: structure of btb/poz transcription repression domain from promelocytic leukemia zinc finger oncoprotein
PDB Compounds: (A:) zinc finger protein plzf

SCOPe Domain Sequences for d1cs3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cs3a_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]}
gmiqlqnpshptgllckanqmrlagtlcdvvimvdsqefhahrtvlactskmfeilfhrn
sqhytldflspktfqqileyaytatlqakaedlddllyaaeileieyleeqclkml

SCOPe Domain Coordinates for d1cs3a_:

Click to download the PDB-style file with coordinates for d1cs3a_.
(The format of our PDB-style files is described here.)

Timeline for d1cs3a_: