Lineage for d1buoa_ (1buo A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31889Fold d.42: POZ domain [54694] (1 superfamily)
  4. 31890Superfamily d.42.1: POZ domain [54695] (2 families) (S)
  5. 31891Family d.42.1.1: BTB/POZ domain [54696] (2 proteins)
  6. 31898Protein Promyelocytic leukemia zinc finger (PLZF) protein BTB domain [54697] (1 species)
  7. 31899Species Human (Homo sapiens) [TaxId:9606] [54698] (2 PDB entries)
  8. 31900Domain d1buoa_: 1buo A: [38631]

Details for d1buoa_

PDB Entry: 1buo (more details), 1.9 Å

PDB Description: btb domain from plzf

SCOP Domain Sequences for d1buoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1buoa_ d.42.1.1 (A:) Promyelocytic leukemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens)}
mgmiqlqnpshptgllckanqmrlagtlcdvvimvdsqefhahrtvlactskmfeilfhr
nsqhytldflspktfqqileyaytatlqakaedlddllyaaeileieyleeqclkmleti
q

SCOP Domain Coordinates for d1buoa_:

Click to download the PDB-style file with coordinates for d1buoa_.
(The format of our PDB-style files is described here.)

Timeline for d1buoa_: