Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids |
Superfamily d.41.5: Molybdopterin synthase subunit MoaE [54690] (1 family) |
Family d.41.5.1: Molybdopterin synthase subunit MoaE [54691] (1 protein) |
Protein Molybdopterin synthase subunit MoaE [54692] (1 species) |
Species Escherichia coli [TaxId:562] [54693] (5 PDB entries) |
Domain d1fm0e_: 1fm0 E: [38629] Other proteins in same PDB: d1fm0d_ complexed with MoaD complexed with cl |
PDB Entry: 1fm0 (more details), 1.45 Å
SCOP Domain Sequences for d1fm0e_:
Sequence, based on SEQRES records: (download)
>d1fm0e_ d.41.5.1 (E:) Molybdopterin synthase subunit MoaE {Escherichia coli [TaxId: 562]} aetkivvgpqpfsvgeeypwlaerdedgavvtftgkvrnhnlgdsvnaltlehypgmtek alaeivdearnrwplgrvtvihrigelwpgdeivfvgvtsahrssafeagqfimdylktr apfwkreatpegdrwvearesdqqaakrw
>d1fm0e_ d.41.5.1 (E:) Molybdopterin synthase subunit MoaE {Escherichia coli [TaxId: 562]} aetkivvgpqpfsvgeeypwlaerdedgavvtftgkvrvnaltlehypgmtekalaeivd earnrwplgrvtvihrigelwpgdeivfvgvtsahrssafeagqfimdylktrapfwkre atpegdrwvearesdqqaakrw
Timeline for d1fm0e_: