Lineage for d1ffkf_ (1ffk F:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1410866Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 1411076Superfamily d.41.4: Ribosomal protein L16p/L10e [54686] (2 families) (S)
  5. 1411077Family d.41.4.1: Ribosomal protein L10e [54687] (1 protein)
  6. 1411078Protein Ribosomal protein L10e [54688] (2 species)
  7. 1411079Species Haloarcula marismortui [TaxId:2238] [54689] (58 PDB entries)
    Uniprot P60617
  8. 1411137Domain d1ffkf_: 1ffk F: [38628]
    Other proteins in same PDB: d1ffk11, d1ffk12, d1ffka1, d1ffka2, d1ffkb_, d1ffkc_, d1ffkd_, d1ffke_, d1ffkg_, d1ffkh_, d1ffki_, d1ffkj_, d1ffkk_, d1ffkl_, d1ffkm_, d1ffkn_, d1ffko_, d1ffkp_, d1ffkq_, d1ffkr_, d1ffks_, d1ffkt_, d1ffku_, d1ffkv_, d1ffkw_, d1ffkx_, d1ffky_, d1ffkz_
    complexed with cd, k, mg

Details for d1ffkf_

PDB Entry: 1ffk (more details), 2.4 Å

PDB Description: crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution
PDB Compounds: (F:) ribosomal protein l10e

SCOPe Domain Sequences for d1ffkf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffkf_ d.41.4.1 (F:) Ribosomal protein L10e {Haloarcula marismortui [TaxId: 2238]}
kpgahfrnsikpaytrreyisgipgkgiaqfkmgnngagptypaqvenvvekpvqirhna
leaarnaanrfvqnsgaaanykfrirkfpfhvireqdgdgmrapfgksvgtaarshganh
dfiawvnpdpavefawrraymkvtptvnidsspagna

SCOPe Domain Coordinates for d1ffkf_:

Click to download the PDB-style file with coordinates for d1ffkf_.
(The format of our PDB-style files is described here.)

Timeline for d1ffkf_: