Lineage for d1ffkf_ (1ffk F:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 602004Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 602120Superfamily d.41.4: Ribosomal protein L16p/L10e [54686] (2 families) (S)
  5. 602121Family d.41.4.1: Ribosomal protein L10e [54687] (1 protein)
  6. 602122Protein Ribosomal protein L10e [54688] (1 species)
  7. 602123Species Archaeon Haloarcula marismortui [TaxId:2238] [54689] (19 PDB entries)
  8. 602128Domain d1ffkf_: 1ffk F: [38628]
    Other proteins in same PDB: d1ffk11, d1ffk12, d1ffka1, d1ffka2, d1ffkc_, d1ffke_, d1ffkg_, d1ffkh_, d1ffki_, d1ffkj_, d1ffkk_, d1ffkl_, d1ffkm_, d1ffkn_, d1ffko_, d1ffkp_, d1ffkq_, d1ffkr_, d1ffks_, d1ffkt_, d1ffku_, d1ffkv_, d1ffkw_, d1ffkx_, d1ffkz_
    complexed with cd, k, mo3; mutant

Details for d1ffkf_

PDB Entry: 1ffk (more details), 2.4 Å

PDB Description: crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution

SCOP Domain Sequences for d1ffkf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffkf_ d.41.4.1 (F:) Ribosomal protein L10e {Archaeon Haloarcula marismortui}
kpgahfrnsikpaytrreyisgipgkgiaqfkmgnngagptypaqvenvvekpvqirhna
leaarnaanrfvqnsgaaanykfrirkfpfhvireqdgdgmrapfgksvgtaarshganh
dfiawvnpdpavefawrraymkvtptvnidsspagna

SCOP Domain Coordinates for d1ffkf_:

Click to download the PDB-style file with coordinates for d1ffkf_.
(The format of our PDB-style files is described here.)

Timeline for d1ffkf_: