Lineage for d6qugf1 (6qug F:1-370)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2913609Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2914680Protein automated matches [190140] (37 species)
    not a true protein
  7. 2914947Species Tetrahymena thermophila [TaxId:312017] [386228] (1 PDB entry)
  8. 2914953Domain d6qugf1: 6qug F:1-370 [386233]
    Other proteins in same PDB: d6quga2, d6qugb2, d6qugc2, d6qugd2, d6quge2, d6qugf2, d6qugg2, d6qugh2, d6qugi2, d6qugj2, d6qugk2, d6qugl2
    automated match to d5b3xa_
    complexed with cu, po4, so4

Details for d6qugf1

PDB Entry: 6qug (more details), 2.7 Å

PDB Description: ghk tagged mbp-nup98(1-29)
PDB Compounds: (F:) Maltodextrin-binding protein,Nucleoporin, putative

SCOPe Domain Sequences for d6qugf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6qugf1 c.94.1.1 (F:1-370) automated matches {Tetrahymena thermophila [TaxId: 312017]}
kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
fwahdrfggyaqsgllaeitpaaafqdklypftwdavryngkliaypiavealsliynkd
llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyaagkydikd
vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtsav
nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdaa
laaaqtnaaa

SCOPe Domain Coordinates for d6qugf1:

Click to download the PDB-style file with coordinates for d6qugf1.
(The format of our PDB-style files is described here.)

Timeline for d6qugf1: