Lineage for d2tpt_3 (2tpt 336-440)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 79412Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
  4. 79465Superfamily d.41.3: Pyrimidine nucleoside phosphorylase C-terminal domain [54680] (1 family) (S)
  5. 79466Family d.41.3.1: Pyrimidine nucleoside phosphorylase C-terminal domain [54681] (2 proteins)
  6. 79471Protein Thymidine phosphorylase [54682] (1 species)
  7. 79472Species Escherichia coli [TaxId:562] [54683] (4 PDB entries)
  8. 79473Domain d2tpt_3: 2tpt 336-440 [38621]
    Other proteins in same PDB: d2tpt_1, d2tpt_2

Details for d2tpt_3

PDB Entry: 2tpt (more details), 2.6 Å

PDB Description: structural and theoretical studies suggest domain movement produces an active conformation of thymidine phosphorylase

SCOP Domain Sequences for d2tpt_3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2tpt_3 d.41.3.1 (336-440) Thymidine phosphorylase {Escherichia coli}
tamltkavyadtegfvsemdtralgmavvamgggrrqasdtidysvgftdmarlgdqvdg
qrplavihakdennwqeaakavkaaikladkapestptvyrrise

SCOP Domain Coordinates for d2tpt_3:

Click to download the PDB-style file with coordinates for d2tpt_3.
(The format of our PDB-style files is described here.)

Timeline for d2tpt_3: