Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein Ubiquitin [54238] (9 species) |
Species Human (Homo sapiens) [TaxId:9606] [54239] (312 PDB entries) Uniprot P62988 identical sequence in many other species |
Domain d6w9dc_: 6w9d C: [385932] Other proteins in same PDB: d6w9da1, d6w9da2, d6w9dd1, d6w9dd2, d6w9dg1, d6w9dg2 automated match to d4k1rb_ complexed with iod, zn |
PDB Entry: 6w9d (more details), 3.19 Å
SCOPe Domain Sequences for d6w9dc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6w9dc_ d.15.1.1 (C:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn iqkestlhlvlr
Timeline for d6w9dc_: