Lineage for d1ffvb1 (1ffv B:7-146)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 79412Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
  4. 79413Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (1 family) (S)
  5. 79414Family d.41.1.1: CO dehydrogenase molybdoprotein N-domain-like [54666] (3 proteins)
  6. 79420Protein Carbon monoxide (CO) dehydrogenase molybdoprotein, N-domain [54672] (2 species)
  7. 79421Species Hydrogenophaga pseudoflava [TaxId:47421] [54674] (2 PDB entries)
  8. 79422Domain d1ffvb1: 1ffv B:7-146 [38591]
    Other proteins in same PDB: d1ffva1, d1ffva2, d1ffvb2, d1ffvc1, d1ffvc2, d1ffvd1, d1ffvd2, d1ffve2, d1ffvf1, d1ffvf2

Details for d1ffvb1

PDB Entry: 1ffv (more details), 2.25 Å

PDB Description: carbon monoxide dehydrogenase from hydrogenophaga pseudoflava

SCOP Domain Sequences for d1ffvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffvb1 d.41.1.1 (B:7-146) Carbon monoxide (CO) dehydrogenase molybdoprotein, N-domain {Hydrogenophaga pseudoflava}
daearelalagmgasrlrkedarfiqgkgnyvddikmpgmlhmdivrapiahgrikkihk
daalampgvhavltaedlkplklhwmptlagdvaavladekvhfqmqevaiviaddryia
adaveavkveydelpvvidp

SCOP Domain Coordinates for d1ffvb1:

Click to download the PDB-style file with coordinates for d1ffvb1.
(The format of our PDB-style files is described here.)

Timeline for d1ffvb1: