Lineage for d1qj2h1 (1qj2 H:10-146)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 132648Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
  4. 132649Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (1 family) (S)
  5. 132650Family d.41.1.1: CO dehydrogenase molybdoprotein N-domain-like [54666] (4 proteins)
  6. 132656Protein Carbon monoxide (CO) dehydrogenase molybdoprotein, N-domain [54672] (2 species)
  7. 132662Species Pseudomonas carboxydovorans [54673] (1 PDB entry)
  8. 132664Domain d1qj2h1: 1qj2 H:10-146 [38590]
    Other proteins in same PDB: d1qj2a1, d1qj2a2, d1qj2b2, d1qj2c1, d1qj2c2, d1qj2g1, d1qj2g2, d1qj2h2, d1qj2i1, d1qj2i2

Details for d1qj2h1

PDB Entry: 1qj2 (more details), 2.2 Å

PDB Description: co dehydrogenase from oligotropha carboxidovorans

SCOP Domain Sequences for d1qj2h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qj2h1 d.41.1.1 (H:10-146) Carbon monoxide (CO) dehydrogenase molybdoprotein, N-domain {Pseudomonas carboxydovorans}
tsaeraeklqgmgckrkrvedirftegkgnyvddvklpgmlfgdfvrsshahariksidt
skakalpgvfavltaadlkplnlhymptlagdvqavladekvlfqnqevafvvakdryva
adaielvevdyeplpvl

SCOP Domain Coordinates for d1qj2h1:

Click to download the PDB-style file with coordinates for d1qj2h1.
(The format of our PDB-style files is described here.)

Timeline for d1qj2h1: