Lineage for d1qj2b1 (1qj2 B:10-146)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 191221Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
  4. 191222Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (1 family) (S)
  5. 191223Family d.41.1.1: CO dehydrogenase molybdoprotein N-domain-like [54666] (4 proteins)
  6. 191229Protein Carbon monoxide (CO) dehydrogenase molybdoprotein, N-domain [54672] (2 species)
  7. 191235Species Pseudomonas carboxydovorans [54673] (1 PDB entry)
  8. 191236Domain d1qj2b1: 1qj2 B:10-146 [38589]
    Other proteins in same PDB: d1qj2a1, d1qj2a2, d1qj2b2, d1qj2c1, d1qj2c2, d1qj2g1, d1qj2g2, d1qj2h2, d1qj2i1, d1qj2i2

Details for d1qj2b1

PDB Entry: 1qj2 (more details), 2.2 Å

PDB Description: co dehydrogenase from oligotropha carboxidovorans

SCOP Domain Sequences for d1qj2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qj2b1 d.41.1.1 (B:10-146) Carbon monoxide (CO) dehydrogenase molybdoprotein, N-domain {Pseudomonas carboxydovorans}
tsaeraeklqgmgckrkrvedirftqgkgnyvddvklpgmlfgdfvrsshahariksidt
skakalpgvfavltaadlkplnlhymptlagdvqavladekvlfqnqevafvvakdryva
adaielvevdyeplpvl

SCOP Domain Coordinates for d1qj2b1:

Click to download the PDB-style file with coordinates for d1qj2b1.
(The format of our PDB-style files is described here.)

Timeline for d1qj2b1: