Lineage for d6s8cc1 (6s8c C:303-403)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 2766575Species Tick-borne encephalitis virus [TaxId:11084] [364682] (3 PDB entries)
  8. 2766580Domain d6s8cc1: 6s8c C:303-403 [385812]
    Other proteins in same PDB: d6s8cb1
    automated match to d4gsxa2

Details for d6s8cc1

PDB Entry: 6s8c (more details), 2.57 Å

PDB Description: post-fusion conformation of the envelope protein of tick-borne encephalitis virus with longer stem
PDB Compounds: (C:) Genome polyprotein,Genome polyprotein

SCOPe Domain Sequences for d6s8cc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6s8cc1 b.1.18.0 (C:303-403) automated matches {Tick-borne encephalitis virus [TaxId: 11084]}
tytmcdktkftwkraptdsghdtvvmevtfsgtkpcripvravahgspdvnvamlitpnp
tienngggfiemqlppgdniiyvgelshqwfqkgssigrvf

SCOPe Domain Coordinates for d6s8cc1:

Click to download the PDB-style file with coordinates for d6s8cc1.
(The format of our PDB-style files is described here.)

Timeline for d6s8cc1: