Lineage for d2ci2i_ (2ci2 I:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31776Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily)
  4. 31777Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (1 family) (S)
  5. 31778Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (4 proteins)
  6. 31779Protein Chymotrypsin inhibitor CI-2 [54658] (1 species)
  7. 31780Species Barley (Hordeum vulgare) [TaxId:4513] [54659] (10 PDB entries)
  8. 31787Domain d2ci2i_: 2ci2 I: [38575]

Details for d2ci2i_

PDB Entry: 2ci2 (more details), 2 Å

PDB Description: crystal and molecular structure of the serine proteinase inhibitor ci- 2 from barley seeds

SCOP Domain Sequences for d2ci2i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ci2i_ d.40.1.1 (I:) Chymotrypsin inhibitor CI-2 {Barley (Hordeum vulgare)}
nlktewpelvgksveeakkvilqdkpeaqiivlpvgtivtmeyridrvrlfvdkldniae
vprvg

SCOP Domain Coordinates for d2ci2i_:

Click to download the PDB-style file with coordinates for d2ci2i_.
(The format of our PDB-style files is described here.)

Timeline for d2ci2i_: