Lineage for d6wopa_ (6wop A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2504326Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2504327Protein automated matches [190151] (160 species)
    not a true protein
  7. 2504328Species Acinetobacter baumannii [TaxId:575584] [385676] (1 PDB entry)
  8. 2504329Domain d6wopa_: 6wop A: [385681]
    automated match to d1sffa_
    complexed with cl, tar

Details for d6wopa_

PDB Entry: 6wop (more details), 1.85 Å

PDB Description: crystal structure of gamma-aminobutyrate aminotransferase puue from acinetobacter baumannii
PDB Compounds: (A:) 4-aminobutyrate transaminase

SCOPe Domain Sequences for d6wopa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6wopa_ c.67.1.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 575584]}
tqhsalnarkqqatprgvgvmcqwyaekaenatiwdkegnqfidfaggiavlntghrhpk
viaavteqltkfthtayqvtpyesyvalaerinerapiagpakaaffttgaeavenavki
arcytgrhgiitfgngfhgrsfmtmamtgktapykrdfgvmpagvfharypvpakgisvd
aaiesvedifsediaphdvaaivlepvqgeggfnvvpaeflkrlraicdkhgillvadev
qsgfartgklfamnhyetkadlitmakslgggfpisgvvgraevmdapnpgglggtyags
piavaaahavidaieeenlcdranelgaelvatlkdiqqatgdvvtdiralgsmvavele
taeqakvvqnyamenglllltcgkygnvirflypltipaeqfrqgldilkqgfatlk

SCOPe Domain Coordinates for d6wopa_:

Click to download the PDB-style file with coordinates for d6wopa_.
(The format of our PDB-style files is described here.)

Timeline for d6wopa_: