Lineage for d1acbi_ (1acb I:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily)
    alpha+beta sandwich; loop across free side of beta-sheet
  4. Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (2 families) (S)
  5. Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (5 proteins)
    automatically mapped to Pfam PF00280
  6. Protein Eglin C [54656] (1 species)
  7. Species Medicinal leech (Hirudo medicinalis) [TaxId:6421] [54657] (11 PDB entries)
  8. Domain d1acbi_: 1acb I: [38565]
    Other proteins in same PDB: d1acbe_

Details for d1acbi_

PDB Entry: 1acb (more details), 2 Å

PDB Description: crystal and molecular structure of the bovine alpha-chymotrypsin-eglin c complex at 2.0 angstroms resolution
PDB Compounds: (I:) eglin c

SCOPe Domain Sequences for d1acbi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1acbi_ d.40.1.1 (I:) Eglin C {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]}
ksfpevvgktvdqareyftlhypqydvyflpegspvtldlrynrvrvfynpgtnvvnhvp
hvg

SCOPe Domain Coordinates for d1acbi_ are not available.

Timeline for d1acbi_:

Domains from other chains:
(mouse over for more information)
d1acbe_