Lineage for d1meei_ (1mee I:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31776Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily)
  4. 31777Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (1 family) (S)
  5. 31778Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (4 proteins)
  6. 31791Protein Eglin C [54656] (1 species)
  7. 31792Species Leech (Hirudo medicinalis) [TaxId:6421] [54657] (11 PDB entries)
  8. 31796Domain d1meei_: 1mee I: [38562]
    Other proteins in same PDB: d1meea_

Details for d1meei_

PDB Entry: 1mee (more details), 2 Å

PDB Description: the complex between the subtilisin from a mesophilic bacterium and the leech inhibitor eglin-c

SCOP Domain Sequences for d1meei_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1meei_ d.40.1.1 (I:) Eglin C {Leech (Hirudo medicinalis)}
lksfpevvgktvdqareyftlhypqynvyflpegspvtldlrynrvrvfynpgtnvvnhv
phvg

SCOP Domain Coordinates for d1meei_:

Click to download the PDB-style file with coordinates for d1meei_.
(The format of our PDB-style files is described here.)

Timeline for d1meei_:

31796
d1meei_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1meea_