Lineage for d2seci_ (2sec I:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily) Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (1 family) 
Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (4 proteins) Protein Eglin C [54656] (1 species) Species Leech (Hirudo medicinalis) [TaxId:6421] [54657] (11 PDB entries) 
Domain d2seci_: 2sec I: [38560]
Other proteins in same PDB: d2sece_
Details for d2seci_
PDB Entry: 2sec (more details), 1.8 Å
PDB Description: structural comparison of two serine proteinase-protein inhibitor complexes. eglin-c-subtilisin carlsberg and ci-2-subtilisin novo
SCOP Domain Sequences for d2seci_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2seci_ d.40.1.1 (I:) Eglin C {Leech (Hirudo medicinalis)}
lksfpevvgktvdqareyftlhypqynvyflpegspvtldlrynrvrvfynpgtnvvnhv
phvg
SCOP Domain Coordinates for d2seci_:
Click to download the PDB-style file with coordinates for d2seci_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2seci_:
- d2seci_ appears in SCOP 1.57
- d2seci_ appears in the current release, SCOPe 2.08
View in 3D
