SCOPe 2.08: Domain d6tpua1: 6tpu A:513-605

Lineage for d6tpua1 (6tpu A:513-605)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.0: automated matches [191562] (1 protein)
   not a true family

6. Protein automated matches [190976] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188649] (69 PDB entries)

8. Domain d6tpua1: 6tpu A:513-605 [385584]
   Other proteins in same PDB: d6tpua3
   automated match to d2edya1
   complexed with cl

Details for d6tpua1

PDB Entry: 6tpu, 1.55 Å

PDB Description: crystal structures of fniii domain three and four of the human leucocyte common antigen-related protein, lar

PDB Compounds: (A:) Receptor-type tyrosine-protein phosphatase F

SCOPe Domain Sequences for d6tpua1:

Sequence; same for both SEQRES and ATOM records:

>d6tpua1 b.1.2.0 (A:513-605) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aqpadfqaevesdtriqlswllppqeriimyelvywaaededqqhkvtfdptssytledl
kpdtlyrfqlaarsdmgvgvftptieartaqst

Timeline for d6tpua1:

• d6tpua1 first appeared in SCOPe 2.07