SCOPe 2.08: Domain d6jz3b1: 6jz3 B:2-185

Lineage for d6jz3b1 (6jz3 B:2-185)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.0: automated matches [191481] (1 protein)
   not a true family

6. Protein automated matches [190770] (51 species)
   not a true protein

7. Species Ruminococcus gnavus [TaxId:33038] [361245] (8 PDB entries)

8. Domain d6jz3b1: 6jz3 B:2-185 [385433]
   Other proteins in same PDB: d6jz3a2, d6jz3a3, d6jz3b2, d6jz3b3
   automated match to d5c70a1
   complexed with cn0, mrd

Details for d6jz3b1

PDB Entry: 6jz3, 1.5 Å

PDB Description: b-glucuronidase from ruminococcus gnavus in complex with uronic deoxynojirimycin

PDB Compounds: (B:) beta-glucuronidase

SCOPe Domain Sequences for d6jz3b1:

Sequence; same for both SEQRES and ATOM records:

>d6jz3b1 b.18.1.0 (B:2-185) automated matches {Ruminococcus gnavus [TaxId: 33038]}
leyselypiqneyrmmqsldgmwkfqfdpeeigkksgwenglpapvsmpvpssfadfftd
hkerdycgdfwyetefylpaewrnkkiwlrfgsithrgtvycngmeitsheggflpvlad
istvakpgqvnqvvvkinnelnetslpcgatkilnngrklakpyfdffnysglqrsvwvi
alpe

Timeline for d6jz3b1:

• d6jz3b1 first appeared in SCOPe 2.07