SCOPe 2.08: Domain d6wrha2: 6wrh A:62-315

Lineage for d6wrha2 (6wrh A:62-315)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.23: Papain-like viral protease catalytic domain [310648] (2 proteins)
   C-terminal part of Pfam PF08715

6. Protein automated matches [310868] (6 species)
   not a true protein

7. Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [385225] (34 PDB entries)

8. Domain d6wrha2: 6wrh A:62-315 [385226]
   Other proteins in same PDB: d6wrha1, d6wrha3
   automated match to d4m0wa2
   complexed with cl, gol, po4, zn; mutant

Details for d6wrha2

PDB Entry: 6wrh, 1.6 Å

PDB Description: the crystal structure of papain-like protease of sars cov-2 , c111s mutant

PDB Compounds: (A:) non-structural protein 3

SCOPe Domain Sequences for d6wrha2:

Sequence; same for both SEQRES and ATOM records:

>d6wrha2 d.3.1.23 (A:62-315) automated matches {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]}
dtlrveafeyyhttdpsflgrymsalnhtkkwkypqvngltsikwadnnsylatalltlq
qielkfnppalqdayyrarageaanfcalilaycnktvgelgdvretmsylfqhanldsc
krvlnvvcktcgqqqttlkgveavmymgtlsyeqfkkgvqipctcgkqatkylvqqespf
vmmsappaqyelkhgtftcaseytgnyqcghykhitsketlycidgalltksseykgpit
dvfykensytttik

Timeline for d6wrha2:

• d6wrha2 first appeared in SCOPe 2.07