SCOPe 2.08: Domain d6wrha1: 6wrh A:1-61

Lineage for d6wrha1 (6wrh A:1-61)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (31 species)
   not a true protein

7. Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [383234] (35 PDB entries)

8. Domain d6wrha1: 6wrh A:1-61 [385224]
   Other proteins in same PDB: d6wrha2, d6wrha3
   automated match to d4m0wa1
   complexed with cl, gol, po4, zn; mutant

Details for d6wrha1

PDB Entry: 6wrh, 1.6 Å

PDB Description: the crystal structure of papain-like protease of sars cov-2 , c111s mutant

PDB Compounds: (A:) non-structural protein 3

SCOPe Domain Sequences for d6wrha1:

Sequence; same for both SEQRES and ATOM records:

>d6wrha1 d.15.1.0 (A:1-61) automated matches {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]}
evrtikvfttvdninlhtqvvdmsmtygqqfgptyldgadvtkikphnshegktfyvlpn
d

Timeline for d6wrha1:

• d6wrha1 first appeared in SCOPe 2.07