Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
Protein automated matches [190233] (31 species) not a true protein |
Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [383234] (35 PDB entries) |
Domain d6wrha1: 6wrh A:1-61 [385224] Other proteins in same PDB: d6wrha2, d6wrha3 automated match to d4m0wa1 complexed with cl, gol, po4, zn; mutant |
PDB Entry: 6wrh (more details), 1.6 Å
SCOPe Domain Sequences for d6wrha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6wrha1 d.15.1.0 (A:1-61) automated matches {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]} evrtikvfttvdninlhtqvvdmsmtygqqfgptyldgadvtkikphnshegktfyvlpn d
Timeline for d6wrha1: