SCOPe 2.08: Domain d6u1db1: 6u1d B:-1-114

Lineage for d6u1db1 (6u1d B:-1-114)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.0: automated matches [227183] (1 protein)
   not a true family

6. Protein automated matches [226903] (40 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:300852] [346285] (10 PDB entries)

8. Domain d6u1db1: 6u1d B:-1-114 [385131]
   Other proteins in same PDB: d6u1da2, d6u1da3, d6u1db2, d6u1db3
   automated match to d2fb9a1
   complexed with atp, dal, mg, rb

Details for d6u1db1

PDB Entry: 6u1d, 1.9 Å

PDB Description: thermus thermophilus d-alanine-d-alanine ligase in complex with atp, d-alanine-d-alanine, mg2+ and rb+

PDB Compounds: (B:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d6u1db1:

Sequence; same for both SEQRES and ATOM records:

>d6u1db1 c.30.1.0 (B:-1-114) automated matches {Thermus thermophilus [TaxId: 300852]}
memrvlliaggvspehevsllsaegvlrhipfptdlaviaqdgrwllgekaltaleakaa
pegehpfppplswerydvvfpllhgrfgedgtvqgflellgkpyvgagvaasalcm

Timeline for d6u1db1:

• d6u1db1 first appeared in SCOPe 2.07