SCOPe 2.08: Domain d6u1cc2: 6u1c C:115-319

Lineage for d6u1cc2 (6u1c C:115-319)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families)

5. Family d.142.1.0: automated matches [227184] (1 protein)
   not a true family

6. Protein automated matches [226904] (39 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:300852] [346384] (13 PDB entries)

8. Domain d6u1cc2: 6u1c C:115-319 [385115]
   Other proteins in same PDB: d6u1ca1, d6u1ca3, d6u1ca4, d6u1cb1, d6u1cc1, d6u1cc3, d6u1cc4, d6u1cd1
   automated match to d2fb9a2

Details for d6u1cc2

PDB Entry: 6u1c, 2.2 Å

PDB Description: apo form of thermus thermophilus d-alanine-d-alanine ligase

PDB Compounds: (C:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d6u1cc2:

Sequence, based on SEQRES records:

>d6u1cc2 d.142.1.0 (C:115-319) automated matches {Thermus thermophilus [TaxId: 300852]}
dkdlskrvlaqagvpvvpwvavrkgeppvvpfdppffvkpantgssvgisrverfqdlea
alalafrydekavvekalspvrelevgvlgnvfgeaspvgevryeapfydyetkytpgra
ellipapldpgtqetvqelalkaykvlgvrgmarvdfflaegelylnelntipgftptsm
yprlfeaggvaypellrrlvelalt

Sequence, based on observed residues (ATOM records):

>d6u1cc2 d.142.1.0 (C:115-319) automated matches {Thermus thermophilus [TaxId: 300852]}
dkdlskrvlaqagvpvvpwvavrkeppvvpfdppffvkpantsvgisrverfqdleaala
lafrydekavvekalspvrelevgvlgnvfgeaspvgevraellipapldgtqetvqela
lkaykvlgvrgmarvdfflaegelylnelntipgftsmyprlfeaggvaypellrrlvel
alt

Timeline for d6u1cc2:

• d6u1cc2 first appeared in SCOPe 2.07