Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) |
Family d.142.1.0: automated matches [227184] (1 protein) not a true family |
Protein automated matches [226904] (39 species) not a true protein |
Species Thermus thermophilus [TaxId:300852] [346384] (13 PDB entries) |
Domain d6u1da2: 6u1d A:115-319 [385083] Other proteins in same PDB: d6u1da1, d6u1da3, d6u1db1, d6u1db3 automated match to d2fb9a2 complexed with atp, dal, mg, rb |
PDB Entry: 6u1d (more details), 1.9 Å
SCOPe Domain Sequences for d6u1da2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6u1da2 d.142.1.0 (A:115-319) automated matches {Thermus thermophilus [TaxId: 300852]} dkdlskrvlaqagvpvvpwvavrkgeppvvpfdppffvkpantgssvgisrverfqdlea alalafrydekavvekalspvrelevgvlgnvfgeaspvgevryeapfydyetkytpgra ellipapldpgtqetvqelalkaykvlgvrgmarvdfflaegelylnelntipgftptsm yprlfeaggvaypellrrlvelalt
Timeline for d6u1da2: