Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) |
Family d.142.1.0: automated matches [227184] (1 protein) not a true family |
Protein automated matches [226904] (39 species) not a true protein |
Species Thermus thermophilus [TaxId:300852] [346384] (13 PDB entries) |
Domain d6u1kd2: 6u1k D:115-319 [385066] Other proteins in same PDB: d6u1ka1, d6u1ka3, d6u1kb1, d6u1kb3, d6u1kc1, d6u1kc3, d6u1kd1, d6u1kd3 automated match to d2fb9a2 complexed with adp, co3, dal, k, mg |
PDB Entry: 6u1k (more details), 1.67 Å
SCOPe Domain Sequences for d6u1kd2:
Sequence, based on SEQRES records: (download)
>d6u1kd2 d.142.1.0 (D:115-319) automated matches {Thermus thermophilus [TaxId: 300852]} dkdlskrvlaqagvpvvpwvavrkgeppvvpfdppffvkpantgssvgisrverfqdlea alalafrydekavvekalspvrelevgvlgnvfgeaspvgevryeapfydyetkytpgra ellipapldpgtqetvqelalkaykvlgvrgmarvdfflaegelylnelntipgftptsm yprlfeaggvaypellrrlvelalt
>d6u1kd2 d.142.1.0 (D:115-319) automated matches {Thermus thermophilus [TaxId: 300852]} dkdlskrvlaqagvpvvpwvavrkeppvvpfdppffvkpantgssvgisrverfqdleaa lalafrydekavvekalspvrelevgvlgnvfgeaspvgevryeapfydyetkytpgrae llipapldpgtqetvqelalkaykvlgvrgmarvdfflaegelylnelntipgftptsmy prlfeaggvaypellrrlvelalt
Timeline for d6u1kd2: