Lineage for d6sqsb_ (6sqs B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2507728Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2507729Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2507730Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2507955Protein automated matches [190124] (13 species)
    not a true protein
  7. 2507970Species Human (Homo sapiens) [TaxId:9606] [186848] (56 PDB entries)
  8. 3084972Domain d6sqsb_: 6sqs B: [385034]
    Other proteins in same PDB: d6sqsc1, d6sqsc2, d6sqsf1, d6sqsf2
    automated match to d4v3ka_
    complexed with sep, zn

Details for d6sqsb_

PDB Entry: 6sqs (more details), 1.83 Å

PDB Description: crystal structure of cat phospho-ser429 mdm2 ring domain bound to ubch5b-ub
PDB Compounds: (B:) ubiquitin-conjugating enzyme e2 d2

SCOPe Domain Sequences for d6sqsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6sqsb_ d.20.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
alkrihkelndlardppaqcragpvgddmfhwqatimgpndspyqggvffltihfptdyp
fkppkvafttriyhpninsngsikldilrsqwspaltiskvllsicsllcdpnpddplvp
eiariyktdrekynriarewtqkyam

SCOPe Domain Coordinates for d6sqsb_:

Click to download the PDB-style file with coordinates for d6sqsb_.
(The format of our PDB-style files is described here.)

Timeline for d6sqsb_:

  • d6sqsb_ is new in SCOPe 2.07-stable