Lineage for d1eima1 (1eim A:1-132)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (5 families) 
Family d.32.1.3: Extradiol dioxygenases [54602] (3 proteins) Protein 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) [54603] (2 species) 
Species Pseudomonas sp. [TaxId:306] [54604] (6 PDB entries) 
Domain d1eima1: 1eim A:1-132 [38496]
Details for d1eima1
PDB Entry: 1eim (more details), 2 Å
PDB Description: 2,3-dihydroxybiphenyl-1,2-dioxygenase
SCOP Domain Sequences for d1eima1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eima1 d.32.1.3 (A:1-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp.}
sierlgylgfavkdvpawdhfltksvglmaagsagdaalyradqrawriavqpgelddla
yaglevddaaalermadklrqagvaftrgdealmqqrkvmgllclqdpfglpleiyygpa
eifhepflpsap
SCOP Domain Coordinates for d1eima1:
Click to download the PDB-style file with coordinates for d1eima1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1eima1:
- d1eima1 first appeared (with stable ids) in SCOP 1.55
- d1eima1 appears in SCOP 1.59
- d1eima1 does not appear in SCOP 1.63
View in 3D
