Lineage for d6t0bq_ (6t0b Q:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2633065Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 2633066Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family) (S)
    location - intermembrane side of the bc1 complex
    automatically mapped to Pfam PF02320
  5. 2633067Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (2 proteins)
    "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1
  6. 2633101Protein automated matches [190042] (4 species)
    not a true protein
  7. 2633128Species Saccharomyces cerevisiae [TaxId:559292] [384636] (1 PDB entry)
  8. 2633129Domain d6t0bq_: 6t0b Q: [384637]
    Other proteins in same PDB: d6t0ba1, d6t0ba2, d6t0bb1, d6t0bb2, d6t0bc1, d6t0bc2, d6t0bd1, d6t0bd2, d6t0be1, d6t0be2, d6t0bf_, d6t0bg_, d6t0bh_, d6t0bi_, d6t0bj_, d6t0bl1, d6t0bl2, d6t0bm1, d6t0bm2, d6t0bn1, d6t0bn2, d6t0bo1, d6t0bo2, d6t0bp1, d6t0bp2, d6t0br_, d6t0bs_, d6t0bt_, d6t0bw_
    automated match to d1kb9f_
    complexed with ca, cdl, cu, cua, fes, hea, hec, hem, mg, pcf, pef, zn

Details for d6t0bq_

PDB Entry: 6t0b (more details), 2.8 Å

PDB Description: the iii2-iv(5b)2 respiratory supercomplex from s. cerevisiae
PDB Compounds: (Q:) Cytochrome b-c1 complex subunit 6

SCOPe Domain Sequences for d6t0bq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6t0bq_ f.28.1.1 (Q:) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
evtdqledlrehfknteegkalvhhyeecaervkiqqqqpgyadlehkedcveeffhlqh
yldtataprlfdklk

SCOPe Domain Coordinates for d6t0bq_:

Click to download the PDB-style file with coordinates for d6t0bq_.
(The format of our PDB-style files is described here.)

Timeline for d6t0bq_: