SCOP 1.55: Domain d1ffku_: 1ffk U:

Lineage for d1ffku_ (1ffk U:)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.29: Ribosomal protein L31e [54574] (1 superfamily)

4. Superfamily d.29.1: Ribosomal protein L31e [54575] (1 family)

5. Family d.29.1.1: Ribosomal protein L31e [54576] (1 protein)

6. Protein Ribosomal protein L31e [54577] (1 species)

7. Species Haloarcula marismortui [TaxId:2238] [54578] (1 PDB entry)

8. Domain d1ffku_: 1ffk U: [38458]
   Other proteins in same PDB: d1ffk11, d1ffk12, d1ffka1, d1ffka2, d1ffkb_, d1ffkc_, d1ffkd_, d1ffke_, d1ffkf_, d1ffkg_, d1ffkh_, d1ffki_, d1ffkj_, d1ffkk_, d1ffkl_, d1ffkm_, d1ffkn_, d1ffko_, d1ffkp_, d1ffkq_, d1ffkr_, d1ffks_, d1ffkt_, d1ffkv_, d1ffkw_, d1ffkx_, d1ffky_, d1ffkz_

Details for d1ffku_

PDB Entry: 1ffk, 2.4 Å

PDB Description: crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution

SCOP Domain Sequences for d1ffku_:

Sequence; same for both SEQRES and ATOM records:

>d1ffku_ d.29.1.1 (U:) Ribosomal protein L31e {Haloarcula marismortui}
dfeervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargr
antpskirvraarfeeegeaiveae

Timeline for d1ffku_:

• d1ffku_ appears in SCOP 1.57
  
• d1ffku_ appears in the current release, SCOPe 2.08