SCOPe 2.07: Domain d6t0bl2: 6t0b L:240-457

Lineage for d6t0bl2 (6t0b L:240-457)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
   core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta

4. Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families)
   Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues

5. Family d.185.1.1: MPP-like [63412] (7 proteins)
   Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal

6. Protein automated matches [254430] (2 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [257462] (3 PDB entries)

8. Domain d6t0bl2: 6t0b L:240-457 [384579]
   Other proteins in same PDB: d6t0bb1, d6t0bb2, d6t0bc1, d6t0bc2, d6t0bd1, d6t0bd2, d6t0be1, d6t0be2, d6t0bf_, d6t0bg_, d6t0bh_, d6t0bi_, d6t0bj_, d6t0bm1, d6t0bm2, d6t0bn1, d6t0bn2, d6t0bo1, d6t0bo2, d6t0bp1, d6t0bp2, d6t0bq_, d6t0br_, d6t0bs_, d6t0bt_, d6t0bw_
   automated match to d3cx5a2
   complexed with ca, cdl, cu, cua, fes, hea, hec, hem, mg, pcf, pef, zn

Details for d6t0bl2

PDB Entry: 6t0b, 2.8 Å

PDB Description: the iii2-iv(5b)2 respiratory supercomplex from s. cerevisiae

PDB Compounds: (L:) Cytochrome b-c1 complex subunit 1, mitochondrial

SCOPe Domain Sequences for d6t0bl2:

Sequence; same for both SEQRES and ATOM records:

>d6t0bl2 d.185.1.1 (L:240-457) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
kkaaflgsevrlrddtlpkawislavegepvnspnyfvaklaaqifgsynafepasrlqg
iklldniqeyqlcdnfnhfslsykdsglwgfstatrnvtmiddlihftlkqwnrltisvt
dteveraksllklqlgqlyesgnpvndanllgaevlikgsklslgeafkkidaitvkdvk
awagkrlwdqdiaiagtgqieglldymrirsdmsmmrw

Timeline for d6t0bl2:

• d6t0bl2 is new in SCOPe 2.07-stable
  
• d6t0bl2 appears in the current release, SCOPe 2.08