Lineage for d1hnxs_ (1hnx S:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1023082Fold d.28: Ribosomal protein S19 [54569] (1 superfamily)
    alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123
  4. 1023083Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) (S)
  5. 1023084Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein)
  6. 1023085Protein Ribosomal protein S19 [54572] (2 species)
  7. 1023113Species Thermus thermophilus [TaxId:274] [54573] (38 PDB entries)
    Uniprot P80381
  8. 1023133Domain d1hnxs_: 1hnx S: [38455]
    Other proteins in same PDB: d1hnxb_, d1hnxc1, d1hnxc2, d1hnxd_, d1hnxe1, d1hnxe2, d1hnxf_, d1hnxg_, d1hnxh_, d1hnxi_, d1hnxj_, d1hnxk_, d1hnxl_, d1hnxm_, d1hnxn_, d1hnxo_, d1hnxp_, d1hnxq_, d1hnxr_, d1hnxt_, d1hnxv_
    complexed with mg, pcy, zn

Details for d1hnxs_

PDB Entry: 1hnx (more details), 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with pactamycin
PDB Compounds: (S:) 30S ribosomal protein S19

SCOPe Domain Sequences for d1hnxs_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnxs_ d.28.1.1 (S:) Ribosomal protein S19 {Thermus thermophilus [TaxId: 274]}
prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
itenmvghklgefaptrtyr

SCOPe Domain Coordinates for d1hnxs_:

Click to download the PDB-style file with coordinates for d1hnxs_.
(The format of our PDB-style files is described here.)

Timeline for d1hnxs_: