Lineage for d1hnws_ (1hnw S:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 327487Fold d.28: Ribosomal protein S19 [54569] (1 superfamily)
    alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123
  4. 327488Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) (S)
  5. 327489Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein)
  6. 327490Protein Ribosomal protein S19 [54572] (1 species)
  7. 327491Species Thermus thermophilus [TaxId:274] [54573] (16 PDB entries)
  8. 327497Domain d1hnws_: 1hnw S: [38454]
    Other proteins in same PDB: d1hnwb_, d1hnwc1, d1hnwc2, d1hnwd_, d1hnwe1, d1hnwe2, d1hnwf_, d1hnwg_, d1hnwh_, d1hnwi_, d1hnwj_, d1hnwk_, d1hnwl_, d1hnwm_, d1hnwn_, d1hnwo_, d1hnwp_, d1hnwq_, d1hnwr_, d1hnwt_, d1hnwv_
    complexed with mg, tac, zn

Details for d1hnws_

PDB Entry: 1hnw (more details), 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline

SCOP Domain Sequences for d1hnws_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnws_ d.28.1.1 (S:) Ribosomal protein S19 {Thermus thermophilus}
prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
itenmvghklgefaptrtyr

SCOP Domain Coordinates for d1hnws_:

Click to download the PDB-style file with coordinates for d1hnws_.
(The format of our PDB-style files is described here.)

Timeline for d1hnws_: