![]() | Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
![]() | Fold d.28: Ribosomal protein S19 [54569] (1 superfamily) |
![]() | Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) ![]() |
![]() | Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein) |
![]() | Protein Ribosomal protein S19 [54572] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [54573] (12 PDB entries) |
![]() | Domain d1hnws_: 1hnw S: [38454] Other proteins in same PDB: d1hnwb_, d1hnwc1, d1hnwc2, d1hnwd_, d1hnwe1, d1hnwe2, d1hnwf_, d1hnwg_, d1hnwh_, d1hnwi_, d1hnwj_, d1hnwk_, d1hnwl_, d1hnwm_, d1hnwn_, d1hnwo_, d1hnwp_, d1hnwq_, d1hnwr_, d1hnwt_, d1hnwv_ |
PDB Entry: 1hnw (more details), 3.4 Å
SCOP Domain Sequences for d1hnws_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hnws_ d.28.1.1 (S:) Ribosomal protein S19 {Thermus thermophilus} prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy itenmvghklgefaptrtyr
Timeline for d1hnws_: