Lineage for d6t0bs_ (6t0b s:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2340249Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (2 families) (S)
    automatically mapped to Pfam PF02284
  5. 2340355Family a.118.11.0: automated matches [384415] (1 protein)
    not a true family
  6. 2340356Protein automated matches [384416] (1 species)
    not a true protein
  7. 2340357Species Saccharomyces cerevisiae [TaxId:559292] [384417] (1 PDB entry)
  8. 2340359Domain d6t0bs_: 6t0b s: [384519]
    Other proteins in same PDB: d6t0ba1, d6t0ba2, d6t0bb1, d6t0bb2, d6t0bc1, d6t0bc2, d6t0bd1, d6t0bd2, d6t0be1, d6t0be2, d6t0bg_, d6t0bh_, d6t0bi_, d6t0bj_, d6t0bl1, d6t0bl2, d6t0bm1, d6t0bm2, d6t0bn1, d6t0bn2, d6t0bo1, d6t0bo2, d6t0bp1, d6t0bp2, d6t0bq_, d6t0br_, d6t0bt_, d6t0bw_
    automated match to d1ocre_
    complexed with ca, cdl, cu, cua, fes, hea, hec, hem, mg, pcf, pef, zn

Details for d6t0bs_

PDB Entry: 6t0b (more details), 2.8 Å

PDB Description: the iii2-iv(5b)2 respiratory supercomplex from s. cerevisiae
PDB Compounds: (s:) Cytochrome c oxidase subunit 6, mitochondrial

SCOPe Domain Sequences for d6t0bs_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6t0bs_ a.118.11.0 (s:) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
deetfeeftaryekefdeaydlfevqrvlnncfsydlvpapaviekalraarrvndlpta
irvfealkykvenedqykayldelkdvrqelgvplkeelfps

SCOPe Domain Coordinates for d6t0bs_:

Click to download the PDB-style file with coordinates for d6t0bs_.
(The format of our PDB-style files is described here.)

Timeline for d6t0bs_: