Lineage for d1fjgs_ (1fjg S:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 410293Fold d.28: Ribosomal protein S19 [54569] (1 superfamily)
    alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123
  4. 410294Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) (S)
  5. 410295Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein)
  6. 410296Protein Ribosomal protein S19 [54572] (1 species)
  7. 410297Species Thermus thermophilus [TaxId:274] [54573] (16 PDB entries)
  8. 410298Domain d1fjgs_: 1fjg S: [38451]
    Other proteins in same PDB: d1fjgb_, d1fjgc1, d1fjgc2, d1fjgd_, d1fjge1, d1fjge2, d1fjgf_, d1fjgg_, d1fjgh_, d1fjgi_, d1fjgj_, d1fjgk_, d1fjgl_, d1fjgm_, d1fjgn_, d1fjgo_, d1fjgp_, d1fjgq_, d1fjgr_, d1fjgt_, d1fjgv_
    complexed with mg, par, scm, sry, zn

Details for d1fjgs_

PDB Entry: 1fjg (more details), 3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin

SCOP Domain Sequences for d1fjgs_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fjgs_ d.28.1.1 (S:) Ribosomal protein S19 {Thermus thermophilus}
prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
itenmvghklgefaptrtyrghgk

SCOP Domain Coordinates for d1fjgs_:

Click to download the PDB-style file with coordinates for d1fjgs_.
(The format of our PDB-style files is described here.)

Timeline for d1fjgs_: