SCOP 1.57: Domain d1fjfs_: 1fjf S:

Lineage for d1fjfs_ (1fjf S:)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.28: Ribosomal protein S19 [54569] (1 superfamily)

4. Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family)

5. Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein)

6. Protein Ribosomal protein S19 [54572] (1 species)

7. Species Thermus thermophilus [TaxId:274] [54573] (12 PDB entries)

8. Domain d1fjfs_: 1fjf S: [38450]
   Other proteins in same PDB: d1fjfb_, d1fjfc1, d1fjfc2, d1fjfd_, d1fjfe1, d1fjfe2, d1fjff_, d1fjfg_, d1fjfh_, d1fjfi_, d1fjfj_, d1fjfk_, d1fjfl_, d1fjfm_, d1fjfn_, d1fjfo_, d1fjfp_, d1fjfq_, d1fjfr_, d1fjft_, d1fjfv_

Details for d1fjfs_

PDB Entry: 1fjf, 3.05 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit

SCOP Domain Sequences for d1fjfs_:

Sequence; same for both SEQRES and ATOM records:

>d1fjfs_ d.28.1.1 (S:) Ribosomal protein S19 {Thermus thermophilus}
prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
itenmvghklgefaptrtyr

Timeline for d1fjfs_:

• d1fjfs_ first appeared (with stable ids) in SCOP 1.55
  
• d1fjfs_ last appears in SCOP 1.59