Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
Fold d.28: Ribosomal protein S19 [54569] (1 superfamily) |
Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) |
Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein) |
Protein Ribosomal protein S19 [54572] (1 species) |
Species Thermus thermophilus [TaxId:274] [54573] (12 PDB entries) |
Domain d1fjfs_: 1fjf S: [38450] Other proteins in same PDB: d1fjfb_, d1fjfc1, d1fjfc2, d1fjfd_, d1fjfe1, d1fjfe2, d1fjff_, d1fjfg_, d1fjfh_, d1fjfi_, d1fjfj_, d1fjfk_, d1fjfl_, d1fjfm_, d1fjfn_, d1fjfo_, d1fjfp_, d1fjfq_, d1fjfr_, d1fjft_, d1fjfv_ |
PDB Entry: 1fjf (more details), 3.05 Å
SCOP Domain Sequences for d1fjfs_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fjfs_ d.28.1.1 (S:) Ribosomal protein S19 {Thermus thermophilus} prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy itenmvghklgefaptrtyr
Timeline for d1fjfs_: