SCOP 1.59: Domain d1hnxp_: 1hnx P:

Lineage for d1hnxp_ (1hnx P:)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.27: Ribosomal protein S16 [54564] (1 superfamily)

4. Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family)

5. Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein)

6. Protein Ribosomal protein S16 [54567] (1 species)

7. Species Thermus thermophilus [TaxId:274] [54568] (11 PDB entries)

8. Domain d1hnxp_: 1hnx P: [38449]
   Other proteins in same PDB: d1hnxb_, d1hnxc1, d1hnxc2, d1hnxd_, d1hnxe1, d1hnxe2, d1hnxf_, d1hnxg_, d1hnxh_, d1hnxi_, d1hnxj_, d1hnxk_, d1hnxl_, d1hnxm_, d1hnxn_, d1hnxo_, d1hnxq_, d1hnxr_, d1hnxs_, d1hnxt_, d1hnxv_

Details for d1hnxp_

PDB Entry: 1hnx, 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with pactamycin

SCOP Domain Sequences for d1hnxp_:

Sequence; same for both SEQRES and ATOM records:

>d1hnxp_ d.27.1.1 (P:) Ribosomal protein S16 {Thermus thermophilus}
mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
svgaqptdtarrllrqagvfrqearega

Timeline for d1hnxp_:

• d1hnxp_ first appeared (with stable ids) in SCOP 1.55
  
• d1hnxp_ appears in SCOP 1.57
  
• d1hnxp_ appears in SCOP 1.61
  
• d1hnxp_ appears in the current release, SCOPe 2.08