Lineage for d1emwa_ (1emw A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 857884Fold d.27: Ribosomal protein S16 [54564] (1 superfamily)
    beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234
  4. 857885Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) (S)
  5. 857886Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein)
  6. 857887Protein Ribosomal protein S16 [54567] (3 species)
  7. 857917Species Thermus thermophilus [TaxId:274] [54568] (37 PDB entries)
    Uniprot P80379
  8. 857943Domain d1emwa_: 1emw A: [38448]

Details for d1emwa_

PDB Entry: 1emw (more details)

PDB Description: solution structure of the ribosomal protein s16 from thermus thermophilus
PDB Compounds: (A:) s16 ribosomal protein

SCOP Domain Sequences for d1emwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1emwa_ d.27.1.1 (A:) Ribosomal protein S16 {Thermus thermophilus [TaxId: 274]}
mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
svgaqptdtarrllrqagvfrqearega

SCOP Domain Coordinates for d1emwa_:

Click to download the PDB-style file with coordinates for d1emwa_.
(The format of our PDB-style files is described here.)

Timeline for d1emwa_: