Lineage for d1hnwp_ (1hnw P:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1023011Fold d.27: Ribosomal protein S16 [54564] (1 superfamily)
    beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234
  4. 1023012Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) (S)
  5. 1023013Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein)
  6. 1023014Protein Ribosomal protein S16 [54567] (3 species)
  7. 1023044Species Thermus thermophilus [TaxId:274] [54568] (37 PDB entries)
    Uniprot P80379
  8. 1023062Domain d1hnwp_: 1hnw P: [38447]
    Other proteins in same PDB: d1hnwb_, d1hnwc1, d1hnwc2, d1hnwd_, d1hnwe1, d1hnwe2, d1hnwf_, d1hnwg_, d1hnwh_, d1hnwi_, d1hnwj_, d1hnwk_, d1hnwl_, d1hnwm_, d1hnwn_, d1hnwo_, d1hnwq_, d1hnwr_, d1hnws_, d1hnwt_, d1hnwv_
    complexed with mg, tac, zn

Details for d1hnwp_

PDB Entry: 1hnw (more details), 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline
PDB Compounds: (P:) 30S ribosomal protein S16

SCOPe Domain Sequences for d1hnwp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnwp_ d.27.1.1 (P:) Ribosomal protein S16 {Thermus thermophilus [TaxId: 274]}
mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
svgaqptdtarrllrqagvfrqearega

SCOPe Domain Coordinates for d1hnwp_:

Click to download the PDB-style file with coordinates for d1hnwp_.
(The format of our PDB-style files is described here.)

Timeline for d1hnwp_: