Lineage for d1hr0p_ (1hr0 P:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1408886Fold d.27: Ribosomal protein S16 [54564] (1 superfamily)
    beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234
  4. 1408887Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) (S)
  5. 1408888Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein)
  6. 1408889Protein Ribosomal protein S16 [54567] (3 species)
  7. 1408919Species Thermus thermophilus [TaxId:274] [54568] (37 PDB entries)
    Uniprot P80379
  8. 1408931Domain d1hr0p_: 1hr0 P: [38446]
    Other proteins in same PDB: d1hr0b_, d1hr0c1, d1hr0c2, d1hr0d_, d1hr0e1, d1hr0e2, d1hr0f_, d1hr0g_, d1hr0h_, d1hr0i_, d1hr0j_, d1hr0k_, d1hr0l_, d1hr0m_, d1hr0n_, d1hr0o_, d1hr0q_, d1hr0r_, d1hr0s_, d1hr0t_, d1hr0v_, d1hr0w_
    complexed with mg, zn

Details for d1hr0p_

PDB Entry: 1hr0 (more details), 3.2 Å

PDB Description: crystal structure of initiation factor if1 bound to the 30s ribosomal subunit
PDB Compounds: (P:) 30S ribosomal protein S16

SCOPe Domain Sequences for d1hr0p_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hr0p_ d.27.1.1 (P:) Ribosomal protein S16 {Thermus thermophilus [TaxId: 274]}
mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
svgaqptdtarrllrqagvfrqe

SCOPe Domain Coordinates for d1hr0p_:

Click to download the PDB-style file with coordinates for d1hr0p_.
(The format of our PDB-style files is described here.)

Timeline for d1hr0p_: