Lineage for d1hr0p_ (1hr0 P:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 79132Fold d.27: Ribosomal protein S16 [54564] (1 superfamily)
  4. 79133Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) (S)
  5. 79134Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein)
  6. 79135Protein Ribosomal protein S16 [54567] (1 species)
  7. 79136Species Thermus thermophilus [TaxId:274] [54568] (11 PDB entries)
  8. 79141Domain d1hr0p_: 1hr0 P: [38446]
    Other proteins in same PDB: d1hr0b_, d1hr0c1, d1hr0c2, d1hr0d_, d1hr0e1, d1hr0e2, d1hr0f_, d1hr0g_, d1hr0h_, d1hr0i_, d1hr0j_, d1hr0k_, d1hr0l_, d1hr0m_, d1hr0n_, d1hr0o_, d1hr0q_, d1hr0r_, d1hr0s_, d1hr0t_, d1hr0v_, d1hr0w_

Details for d1hr0p_

PDB Entry: 1hr0 (more details), 3.2 Å

PDB Description: crystal structure of initiation factor if1 bound to the 30s ribosomal subunit

SCOP Domain Sequences for d1hr0p_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hr0p_ d.27.1.1 (P:) Ribosomal protein S16 {Thermus thermophilus}
mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
svgaqptdtarrllrqagvfrqe

SCOP Domain Coordinates for d1hr0p_:

Click to download the PDB-style file with coordinates for d1hr0p_.
(The format of our PDB-style files is described here.)

Timeline for d1hr0p_: