SCOPe 2.04: Domain d1hnzp_: 1hnz P:

Lineage for d1hnzp_ (1hnz P:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.27: Ribosomal protein S16 [54564] (1 superfamily)
   beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234

4. Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family)

5. Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein)

6. Protein Ribosomal protein S16 [54567] (3 species)

7. Species Thermus thermophilus [TaxId:274] [54568] (37 PDB entries)
   Uniprot P80379

8. Domain d1hnzp_: 1hnz P: [38445]
   Other proteins in same PDB: d1hnzb_, d1hnzc1, d1hnzc2, d1hnzd_, d1hnze1, d1hnze2, d1hnzf_, d1hnzg_, d1hnzh_, d1hnzi_, d1hnzj_, d1hnzk_, d1hnzl_, d1hnzm_, d1hnzn_, d1hnzo_, d1hnzq_, d1hnzr_, d1hnzs_, d1hnzt_, d1hnzv_
   complexed with hyg, mg, zn

Details for d1hnzp_

PDB Entry: 1hnz, 3.3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b

PDB Compounds: (P:) 30S ribosomal protein S16

SCOPe Domain Sequences for d1hnzp_:

Sequence; same for both SEQRES and ATOM records:

>d1hnzp_ d.27.1.1 (P:) Ribosomal protein S16 {Thermus thermophilus [TaxId: 274]}
mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
svgaqptdtarrllrqagvfrqearega

Timeline for d1hnzp_:

• d1hnzp_ first appeared (with stable ids) in SCOP 1.55
  
• d1hnzp_ appears in SCOPe 2.03
  
• d1hnzp_ appears in SCOPe 2.05
  
• d1hnzp_ appears in the current release, SCOPe 2.08