Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.27: Ribosomal protein S16 [54564] (1 superfamily) beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234 |
Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) |
Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein) |
Protein Ribosomal protein S16 [54567] (1 species) |
Species Thermus thermophilus [TaxId:274] [54568] (15 PDB entries) |
Domain d1hnzp_: 1hnz P: [38445] Other proteins in same PDB: d1hnzb_, d1hnzc1, d1hnzc2, d1hnzd_, d1hnze1, d1hnze2, d1hnzf_, d1hnzg_, d1hnzh_, d1hnzi_, d1hnzj_, d1hnzk_, d1hnzl_, d1hnzm_, d1hnzn_, d1hnzo_, d1hnzq_, d1hnzr_, d1hnzs_, d1hnzt_, d1hnzv_ complexed with hyg, mg, zn |
PDB Entry: 1hnz (more details), 3.3 Å
SCOP Domain Sequences for d1hnzp_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hnzp_ d.27.1.1 (P:) Ribosomal protein S16 {Thermus thermophilus} mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl svgaqptdtarrllrqagvfrqearega
Timeline for d1hnzp_: