Lineage for d1fjgp_ (1fjg P:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 190898Fold d.27: Ribosomal protein S16 [54564] (1 superfamily)
  4. 190899Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) (S)
  5. 190900Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein)
  6. 190901Protein Ribosomal protein S16 [54567] (1 species)
  7. 190902Species Thermus thermophilus [TaxId:274] [54568] (11 PDB entries)
  8. 190903Domain d1fjgp_: 1fjg P: [38444]
    Other proteins in same PDB: d1fjgb_, d1fjgc1, d1fjgc2, d1fjgd_, d1fjge1, d1fjge2, d1fjgf_, d1fjgg_, d1fjgh_, d1fjgi_, d1fjgj_, d1fjgk_, d1fjgl_, d1fjgm_, d1fjgn_, d1fjgo_, d1fjgq_, d1fjgr_, d1fjgs_, d1fjgt_, d1fjgv_

Details for d1fjgp_

PDB Entry: 1fjg (more details), 3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin

SCOP Domain Sequences for d1fjgp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fjgp_ d.27.1.1 (P:) Ribosomal protein S16 {Thermus thermophilus}
mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
svgaqptdtarrllrqagvfrqe

SCOP Domain Coordinates for d1fjgp_:

Click to download the PDB-style file with coordinates for d1fjgp_.
(The format of our PDB-style files is described here.)

Timeline for d1fjgp_: